Lineage for d2w9sc_ (2w9s C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2510888Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2510889Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2511486Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2511487Protein automated matches [190777] (27 species)
    not a true protein
  7. 2511735Species Staphylococcus aureus [TaxId:1280] [188848] (13 PDB entries)
  8. 2511741Domain d2w9sc_: 2w9s C: [169147]
    automated match to d1dhja_
    complexed with gol, ndp, top

Details for d2w9sc_

PDB Entry: 2w9s (more details), 1.8 Å

PDB Description: staphylococcus aureus s1:dhfr in complex with trimethoprim
PDB Compounds: (C:) dihydrofolate reductase type 1 from tn4003

SCOPe Domain Sequences for d2w9sc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w9sc_ c.71.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 1280]}
tlsiivahdkqrvigyqnqlpwhlpndlkhikqlttgntlvmarktfesigkplpnrrnv
vltnqasfhhegvdvinsldeikelsghvfifggqtlyeamidqvddmyitvidgkfqgd
tffppytfedwevessvegqldekntiphtflhlvrr

SCOPe Domain Coordinates for d2w9sc_:

Click to download the PDB-style file with coordinates for d2w9sc_.
(The format of our PDB-style files is described here.)

Timeline for d2w9sc_: