Lineage for d1dhja_ (1dhj A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2510888Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2510889Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2510890Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2510976Protein Dihydrofolate reductase, prokaryotic type [53599] (9 species)
  7. 2510992Species Escherichia coli [TaxId:562] [53600] (86 PDB entries)
  8. 2511069Domain d1dhja_: 1dhj A: [34833]
    complexed with ca, cl, mtx; mutant

Details for d1dhja_

PDB Entry: 1dhj (more details), 1.8 Å

PDB Description: long-range structural effects in a second-site revertant of a mutant dihydrofolate reductase
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d1dhja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dhja_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]}
misliaalavdrvigmenampwnlpaslawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvssefhdadaqnshsycfeilerr

SCOPe Domain Coordinates for d1dhja_:

Click to download the PDB-style file with coordinates for d1dhja_.
(The format of our PDB-style files is described here.)

Timeline for d1dhja_: