| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
| Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
| Protein automated matches [190777] (27 species) not a true protein |
| Species Staphylococcus aureus [TaxId:1280] [188848] (13 PDB entries) |
| Domain d2w9sf_: 2w9s F: [169150] automated match to d1dhja_ complexed with gol, ndp, top |
PDB Entry: 2w9s (more details), 1.8 Å
SCOPe Domain Sequences for d2w9sf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w9sf_ c.71.1.0 (F:) automated matches {Staphylococcus aureus [TaxId: 1280]}
tlsiivahdkqrvigyqnqlpwhlpndlkhikqlttgntlvmarktfesigkplpnrrnv
vltnqasfhhegvdvinsldeikelsghvfifggqtlyeamidqvddmyitvidgkfqgd
tffppytfedwevessvegqldekntiphtflhlvrr
Timeline for d2w9sf_: