SCOPe 2.07: Domain d1fyha2: 1fyh A:201-324

Lineage for d1fyha2 (1fyh A:201-324)

Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds)
Fold a.26: 4-helical cytokines [47265] (1 superfamily)
core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
there are two different topoisomers of this fold with different entanglements of the two crossover connections
Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
contains an additional helix in one of the crossover connections
Protein Interferon-gamma [47318] (3 species)
intertwined dimer
Species Human (Homo sapiens) [TaxId:9606] [47320] (5 PDB entries)
Domain d1fyha2: 1fyh A:201-324 [16908]
Other proteins in same PDB: d1fyhb1, d1fyhb2, d1fyhe1, d1fyhe2
a single-chain variant
complexed with cl

Details for d1fyha2

PDB Entry: 1fyh (more details), 2.04 Å

PDB Description: 1:1 complex between an interferon gamma single-chain variant and its receptor

PDB Compounds: (A:) interferon gamma

SCOPe Domain Sequences for d1fyha2:

Sequence, based on SEQRES records: (download)

>d1fyha2 a.26.1.3 (A:201-324) Interferon-gamma {Human (Homo sapiens) [TaxId: 9606]}
sgefvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfknf
kddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmael
spaa

Sequence, based on observed residues (ATOM records): (download)

>d1fyha2 a.26.1.3 (A:201-324) Interferon-gamma {Human (Homo sapiens) [TaxId: 9606]}
sgefvkeaenlkkyfndngtlflgilknwkeesdrkimqsqivsfyfklfknfkddqsiq
ksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmaelspaa

SCOPe Domain Coordinates for d1fyha2:

Click to download the PDB-style file with coordinates for d1fyha2.
(The format of our PDB-style files is described here.)

Timeline for d1fyha2: