| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
| Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins) contains an additional helix in one of the crossover connections |
| Protein Interferon-gamma [47318] (3 species) intertwined dimer |
| Species Human (Homo sapiens) [TaxId:9606] [47320] (4 PDB entries) |
| Domain d1fyha2: 1fyh A:201-324 [16908] Other proteins in same PDB: d1fyhb1, d1fyhb2, d1fyhe1, d1fyhe2 a single-chain variant complexed with cl |
PDB Entry: 1fyh (more details), 2.04 Å
SCOPe Domain Sequences for d1fyha2:
Sequence, based on SEQRES records: (download)
>d1fyha2 a.26.1.3 (A:201-324) Interferon-gamma {Human (Homo sapiens) [TaxId: 9606]}
sgefvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfknf
kddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmael
spaa
>d1fyha2 a.26.1.3 (A:201-324) Interferon-gamma {Human (Homo sapiens) [TaxId: 9606]}
sgefvkeaenlkkyfndngtlflgilknwkeesdrkimqsqivsfyfklfknfkddqsiq
ksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmaelspaa
Timeline for d1fyha2: