Lineage for d2w10b_ (2w10 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783254Protein automated matches [190043] (8 species)
    not a true protein
  7. 2783337Species Mouse (Mus musculus) [TaxId:10090] [187043] (7 PDB entries)
  8. 2783341Domain d2w10b_: 2w10 B: [168993]
    automated match to d1h3ha_
    complexed with po4

Details for d2w10b_

PDB Entry: 2w10 (more details), 1.9 Å

PDB Description: mona sh3c in complex
PDB Compounds: (B:) GRB2-related adaptor protein 2

SCOPe Domain Sequences for d2w10b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w10b_ b.34.2.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
plgsvrwaralydfealeedelgfrsgevvevldssnpswwtgrlhnklglfpanyvapm
mr

SCOPe Domain Coordinates for d2w10b_:

Click to download the PDB-style file with coordinates for d2w10b_.
(The format of our PDB-style files is described here.)

Timeline for d2w10b_:

2783341
d2w10b_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d2w10a_