Lineage for d1h3ha_ (1h3h A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783039Protein Grb2-related adaptor protein 2 (Mona/Gads) [89293] (1 species)
  7. 2783040Species Mouse (Mus musculus) [TaxId:10090] [89294] (3 PDB entries)
  8. 2783044Domain d1h3ha_: 1h3h A: [83468]
    C-terminal domain; complexed with an RxxK-containing slp-76 peptide, chain B

Details for d1h3ha_

PDB Entry: 1h3h (more details)

PDB Description: Structural Basis for Specific Recognition of an RxxK-containing SLP-76 peptide by the Gads C-terminal SH3 domain
PDB Compounds: (A:) GRB2-related adaptor protein 2

SCOPe Domain Sequences for d1h3ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3ha_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]}
grvrwaralydfealeedelgfrsgevvevldssnpswwtgrlhnklglfpanyvapmmr

SCOPe Domain Coordinates for d1h3ha_:

Click to download the PDB-style file with coordinates for d1h3ha_.
(The format of our PDB-style files is described here.)

Timeline for d1h3ha_: