Lineage for d2vxwa1 (2vxw A:10-68)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928974Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2928975Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2928976Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2929310Protein automated matches [190403] (4 species)
    not a true protein
  7. 2929318Species Human (Homo sapiens) [TaxId:9606] [187277] (20 PDB entries)
  8. 2929321Domain d2vxwa1: 2vxw A:10-68 [168925]
    Other proteins in same PDB: d2vxwa2, d2vxwb2, d2vxwc2, d2vxwd2
    automated match to d1hrja_

Details for d2vxwa1

PDB Entry: 2vxw (more details), 1.7 Å

PDB Description: Structural and Functional Studies of the Potent Anti-HIV Chemokine Variant P2-RANTES
PDB Compounds: (A:) c-c motif chemokine 5

SCOPe Domain Sequences for d2vxwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vxwa1 d.9.1.1 (A:10-68) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvreyinslems

SCOPe Domain Coordinates for d2vxwa1:

Click to download the PDB-style file with coordinates for d2vxwa1.
(The format of our PDB-style files is described here.)

Timeline for d2vxwa1: