PDB entry 2vxw

View 2vxw on RCSB PDB site
Description: Structural and Functional Studies of the Potent Anti-HIV Chemokine Variant P2-RANTES
Class: immune system
Keywords: immune system, glycoprotein, cell-cell fusion, inflammatory response, hiv entry, chemotaxis
Deposited on 2008-07-12, released 2008-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-22, with a file datestamp of 2012-08-17.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.2173
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-c motif chemokine 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13501 (10-68)
      • expression tag (0-9)
    Domains in SCOPe 2.07: d2vxwa1, d2vxwa2
  • Chain 'B':
    Compound: c-c motif chemokine 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13501 (10-68)
      • expression tag (0-9)
    Domains in SCOPe 2.07: d2vxwb1, d2vxwb2
  • Chain 'C':
    Compound: c-c motif chemokine 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13501 (10-68)
      • expression tag (6-9)
    Domains in SCOPe 2.07: d2vxwc1, d2vxwc2
  • Chain 'D':
    Compound: c-c motif chemokine 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13501 (10-68)
      • expression tag (7-9)
    Domains in SCOPe 2.07: d2vxwd1, d2vxwd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vxwA (A:)
    fsplssqssaccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvr
    eyinslems
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vxwB (B:)
    fsplssqssaccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvr
    eyinslems
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vxwC (C:)
    fsplssqssaccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvr
    eyinslems
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vxwC (C:)
    qssaccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvreyinsl
    ems
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vxwD (D:)
    fsplssqssaccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvr
    eyinslems
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vxwD (D:)
    ssaccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvreyinsle
    ms