| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
| Protein automated matches [190329] (9 species) not a true protein |
| Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [188489] (3 PDB entries) |
| Domain d2vrpb_: 2vrp B: [168776] automated match to d1iodb_ complexed with cl, na |
PDB Entry: 2vrp (more details), 2.41 Å
SCOPe Domain Sequences for d2vrpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vrpb_ d.169.1.1 (B:) automated matches {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}
dcpsgwssyeghcykpfnepknwadaerfcklqpkhshlvsfqsaeeadfvvkltrprlk
anlvwmglsniwhgcnwqwsdgarlnykdwqeqseclafrgvhtewlnmdcsstcsfvck
fka
Timeline for d2vrpb_: