Lineage for d2vrpb_ (2vrp B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2558907Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2559351Protein automated matches [190329] (10 species)
    not a true protein
  7. 2559406Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [188489] (10 PDB entries)
  8. 2559408Domain d2vrpb_: 2vrp B: [168776]
    automated match to d1iodb_
    complexed with cl, na

Details for d2vrpb_

PDB Entry: 2vrp (more details), 2.41 Å

PDB Description: structure of rhodocytin
PDB Compounds: (B:) Aggretin beta chain

SCOPe Domain Sequences for d2vrpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vrpb_ d.169.1.1 (B:) automated matches {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}
dcpsgwssyeghcykpfnepknwadaerfcklqpkhshlvsfqsaeeadfvvkltrprlk
anlvwmglsniwhgcnwqwsdgarlnykdwqeqseclafrgvhtewlnmdcsstcsfvck
fka

SCOPe Domain Coordinates for d2vrpb_:

Click to download the PDB-style file with coordinates for d2vrpb_.
(The format of our PDB-style files is described here.)

Timeline for d2vrpb_: