Lineage for d2voaa_ (2voa A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594378Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2594379Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2594494Family d.151.1.0: automated matches [191468] (1 protein)
    not a true family
  6. 2594495Protein automated matches [190734] (14 species)
    not a true protein
  7. 2594496Species Archaeoglobus fulgidus [TaxId:2234] [188717] (1 PDB entry)
  8. 2594497Domain d2voaa_: 2voa A: [168746]
    automated match to d1akoa_

Details for d2voaa_

PDB Entry: 2voa (more details), 1.7 Å

PDB Description: structure of an ap endonuclease from archaeoglobus fulgidus
PDB Compounds: (A:) exodeoxyribonuclease III

SCOPe Domain Sequences for d2voaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2voaa_ d.151.1.0 (A:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mlkiatfnvnsirsrlhivipwlkenkpdilcmqetkvenrkfpeadfhrigyhvvfsgs
kgrngvaiasleepedvsfgldsepkdedrlirakiagidvintyvpqgfkidsekyqyk
lqwlerlyhylqktvdfrsfavwcgdmnvapepidvhspdklknhvcfhedarraykkil
elgfvdvlrkihpneriytfydyrvkgaierglgwrgdailatpplaercvdcyadikpr
laekpsdhlplvavfdv

SCOPe Domain Coordinates for d2voaa_:

Click to download the PDB-style file with coordinates for d2voaa_.
(The format of our PDB-style files is described here.)

Timeline for d2voaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2voab_