SCOPe 2.02: Domain d2vjrb_: 2vjr B:

Lineage for d2vjrb_ (2vjr B:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore

6. Protein automated matches [190531] (8 species)
   not a true protein

7. Species Gloeobacter violaceus [TaxId:33072] [188397] (4 PDB entries)

8. Domain d2vjrb_: 2vjr B: [168660]
   automated match to d1i7yb_
   complexed with cyc

Details for d2vjrb_

PDB Entry: 2vjr, 2.6 Å

PDB Description: the structure of phycocyanin from gloeobacter violaceus

PDB Compounds: (B:) phycocyanin beta chain

SCOPe Domain Sequences for d2vjrb_:

Sequence; same for both SEQRES and ATOM records:

>d2vjrb_ a.1.1.3 (B:) automated matches {Gloeobacter violaceus [TaxId: 33072]}
mqdaftkaivaadlrgsflseqelnqltnlvkesnkrldavnaitgnaaeiisdaahklf
aeqtdlirpggnaypnrrmaaclrdmeiilryvsyallagdasvledrclnglketyval
gtptrsvaravqlmketaigyvnspsgvtrgdcsalvneaatyfdkaaasia

Timeline for d2vjrb_:

• d2vjrb_ first appeared in SCOPe 2.01
  
• d2vjrb_ appears in SCOPe 2.03
  
• d2vjrb_ appears in the current release, SCOPe 2.08