| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.299: Ns1 effector domain-like [143020] (1 superfamily) beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7] |
Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family) ![]() |
| Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins) C-terminal part of Pfam PF00600 |
| Protein automated matches [190936] (5 species) not a true protein |
| Species Influenza A virus [TaxId:11320] [188483] (1 PDB entry) |
| Domain d2rhkb_: 2rhk B: [168126] automated match to d2gx9a1 protein/RNA complex; complexed with no3, trs, zn |
PDB Entry: 2rhk (more details)
SCOPe Domain Sequences for d2rhkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rhkb_ d.299.1.1 (B:) automated matches {Influenza A virus [TaxId: 11320]}
pasryitdmtieelsrdwfmlmpkqkvegplciridqaimdknimlkanfsvifdrletl
illrafteegaivgeisplpsfpghtiedvknaigvligglewndntvrvsktlqrfaw
Timeline for d2rhkb_: