PDB entry 2rhk
View 2rhk on RCSB PDB site
Description: Crystal structure of influenza A NS1A protein in complex with F2F3 fragment of human cellular factor CPSF30, Northeast Structural Genomics Targets OR8C and HR6309A
Class: viral protein/nuclear protein
Keywords: Influenza A, Nonstructural protein, viral protein: host complex, Zn finger, Alternative splicing, Cytoplasm, Host-virus interaction, Interferon antiviral system evasion, Nucleus, RNA-binding, Suppressor of RNA silencing, Metal-binding, mRNA processing, Zinc, Zinc-finger, METAL BINDING PROTEIN, VIRAL PROTEIN-METAL BINDING PROTEIN COMPLEX, VIRAL PROTEIN-NUCLEAR PROTEIN COMPLEX, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on
2007-10-09, released
2008-07-01
The last revision prior to the SCOPe 2.01 freeze date was dated
2010-03-31, with a file datestamp of
2010-03-26.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Non-structural protein 1
Species: Influenza A virus [TaxId:11320]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d2rhka_ - Chain 'B':
Compound: Non-structural protein 1
Species: Influenza A virus [TaxId:11320]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d2rhkb_ - Chain 'C':
Compound: Cleavage and polyadenylation specificity factor subunit 4
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot O95639 (11-End)
- expression tag (6-10)
- engineered (44)
- Chain 'D':
Compound: Cleavage and polyadenylation specificity factor subunit 4
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot O95639 (11-End)
- expression tag (8-10)
- engineered (44)
- Heterogens: NO3, ZN, TRS, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2rhkA (A:)
mpasryitdmtieelsrdwfmlmpkqkvegplciridqaimdknimlkanfsvifdrlet
lillrafteegaivgeisplpsfpghtiedvknaigvligglewndntvrvsktlqrfaw
gssnengrppltlehhhhhh
Sequence, based on observed residues (ATOM records): (download)
>2rhkA (A:)
pasryitdmtieelsrdwfmlmpkqkvegplciridqaimdknimlkanfsvifdrletl
illrafteegaivgeisplpsfpghtiedvknaigvligglewndntvrvsktlqrfaw
- Chain 'B':
Sequence, based on SEQRES records: (download)
>2rhkB (B:)
mpasryitdmtieelsrdwfmlmpkqkvegplciridqaimdknimlkanfsvifdrlet
lillrafteegaivgeisplpsfpghtiedvknaigvligglewndntvrvsktlqrfaw
gssnengrppltlehhhhhh
Sequence, based on observed residues (ATOM records): (download)
>2rhkB (B:)
pasryitdmtieelsrdwfmlmpkqkvegplciridqaimdknimlkanfsvifdrletl
illrafteegaivgeisplpsfpghtiedvknaigvligglewndntvrvsktlqrfaw
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.