SCOPe 2.08: Domain d2rhkb_: 2rhk B:

Lineage for d2rhkb_ (2rhk B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.299: Ns1 effector domain-like [143020] (1 superfamily)
   beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7]

4. Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family)
   automatically mapped to Pfam PF00600

5. Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins)
   C-terminal part of Pfam PF00600

6. Protein automated matches [190936] (7 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [188483] (2 PDB entries)

8. Domain d2rhkb_: 2rhk B: [168126]
   automated match to d2gx9a1
   protein/RNA complex; complexed with no3, trs, zn

Details for d2rhkb_

PDB Entry: 2rhk

PDB Description: crystal structure of influenza a ns1a protein in complex with f2f3 fragment of human cellular factor cpsf30, northeast structural genomics targets or8c and hr6309a

PDB Compounds: (B:) Non-structural protein 1

SCOPe Domain Sequences for d2rhkb_:

Sequence; same for both SEQRES and ATOM records:

>d2rhkb_ d.299.1.1 (B:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
pasryitdmtieelsrdwfmlmpkqkvegplciridqaimdknimlkanfsvifdrletl
illrafteegaivgeisplpsfpghtiedvknaigvligglewndntvrvsktlqrfaw

Timeline for d2rhkb_:

• d2rhkb_ first appeared in SCOPe 2.01
  
• d2rhkb_ appears in SCOPe 2.07