Lineage for d2gx9a1 (2gx9 A:79-205)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.299: Ns1 effector domain-like [143020] (1 superfamily)
beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7]Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family) 
automatically mapped to Pfam PF00600Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins)
C-terminal part of Pfam PF00600
Protein Non-structural protein NS1 C-terminal domain [143023] (1 species) Species Influenza A virus, different strains [TaxId:11320] [143024] (1 PDB entry)
Uniprot Q71QT3 79-205
Domain d2gx9a1: 2gx9 A:79-205 [135828]
complexed with scn
Details for d2gx9a1
PDB Entry: 2gx9 (more details), 2.1 Å
PDB Description: x-ray structure of influenza virus ns1 effector domain
PDB Compounds: (A:) NS1 Effector DomainSCOPe Domain Sequences for d2gx9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gx9a1 d.299.1.1 (A:79-205) Non-structural protein NS1 C-terminal domain {Influenza A virus, different strains [TaxId: 11320]}
mtmasvpasryltdmtleemsrdwsmlipkqkvagplcirmdqaimdkniilkanfsvif
drletlillrafteegaivgeisplpslpghtaedvknavgvligglewndntvrvsetl
qrfawrs
SCOPe Domain Coordinates for d2gx9a1:
Click to download the PDB-style file with coordinates for d2gx9a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2gx9a1:
- d2gx9a1 first appeared in SCOP 1.73
- d2gx9a1 appears in SCOPe 2.07
View in 3D
