SCOPe 2.08: Domain d2rfjb1: 2rfj B:21-135

Lineage for d2rfjb1 (2rfj B:21-135)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d2rfjb1: 2rfj B:21-135 [168086]
   Other proteins in same PDB: d2rfja2, d2rfjb2
   automated match to d1jm4b_

Details for d2rfjb1

PDB Entry: 2rfj, 2.05 Å

PDB Description: Crystal structure of the bromo domain 1 in human bromodomain containing protein, testis specific (BRDT)

PDB Compounds: (B:) Bromodomain testis-specific protein

SCOPe Domain Sequences for d2rfjb1:

Sequence, based on SEQRES records:

>d2rfjb1 a.29.2.0 (B:21-135) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ntkkngrltnqlqylqkvvlkdlwkhsfswpfqrpvdavklqlpdyytiiknpmdlntik
krlenkyyakaseciedfntmfsncylynkpgddivlmaqaleklfmqklsqmpq

Sequence, based on observed residues (ATOM records):

>d2rfjb1 a.29.2.0 (B:21-135) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ntnqlqylqkvvlkdlwkhsfswpfqrpvklqlpdyytiiknpmdlntikkrlenkyyak
aseciedfntmfsncylynkpgddivlmaqaleklfmqklsqmpq

Timeline for d2rfjb1:

• d2rfjb1 first appeared in SCOPe 2.01
  
• d2rfjb1 appears in SCOPe 2.07