Lineage for d2rfjc_ (2rfj C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2706959Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)
  8. 2707546Domain d2rfjc_: 2rfj C: [168087]
    Other proteins in same PDB: d2rfja2, d2rfjb2
    automated match to d1jm4b_

Details for d2rfjc_

PDB Entry: 2rfj (more details), 2.05 Å

PDB Description: Crystal structure of the bromo domain 1 in human bromodomain containing protein, testis specific (BRDT)
PDB Compounds: (C:) Bromodomain testis-specific protein

SCOPe Domain Sequences for d2rfjc_:

Sequence, based on SEQRES records: (download)

>d2rfjc_ a.29.2.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nqlqylqkvvlkdlwkhsfswpfqrpvdavklqlpdyytiiknpmdlntikkrlenkyya
kaseciedfntmfsncylynkpgddivlmaqaleklfmqklsqm

Sequence, based on observed residues (ATOM records): (download)

>d2rfjc_ a.29.2.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nqlqylqkvvlkdlwkhsfswpfqrpvklqlpdyytiiknpmdlntikkrlenkyyakas
eciedfntmfsncylynkpgddivlmaqaleklfmqklsqm

SCOPe Domain Coordinates for d2rfjc_:

Click to download the PDB-style file with coordinates for d2rfjc_.
(The format of our PDB-style files is described here.)

Timeline for d2rfjc_: