Lineage for d2r2fb_ (2r2f B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.25: Ferritin-like [47239] (1 superfamily) Superfamily a.25.1: Ferritin-like [47240] (2 families) 
Family a.25.1.2: Ribonucleotide reductase-like [47253] (4 proteins) 
Protein Ribonucleotide reductase R2 [47257] (3 species) 
Species Salmonella typhimurium [TaxId:90371] [47259] (2 PDB entries) 
Domain d2r2fb_: 2r2f B: [16803]
Details for d2r2fb_
PDB Entry: 2r2f (more details), 2.25 Å
PDB Description: ribonucleotide reductase r2f protein from salmonella typhimurium (oxidized)
SCOP Domain Sequences for d2r2fb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r2fb_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Salmonella typhimurium}
klsrisainwnkiqddkdlevwnrltsnfwlpekvplsndipawqtlsaaeqqltirvft
gltlldtiqniagapslmadaitpheeavlsnisfmeavharsyssifstlcqtkevdaa
yawseenpplqrkaqiilahyvsdeplkkkiasvflesflfysgfwlpmyfssrgkltnt
adlirliirdeavhgyyigykyqialqklsaiereelklfaldllmelydneirytealy
aetgwvndvkaflcynankalmnlgyealfppemadvnpailaal
SCOP Domain Coordinates for d2r2fb_:
Click to download the PDB-style file with coordinates for d2r2fb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2r2fb_:
- d2r2fb_ appears in SCOP 1.57
- d2r2fb_ appears in the current release, SCOPe 2.08
View in 3D
