SCOPe 2.08: Domain d2r6ta_: 2r6t A:

Lineage for d2r6ta_ (2r6t A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families)
   crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site

5. Family a.25.2.0: automated matches [191442] (1 protein)
   not a true family

6. Protein automated matches [190652] (6 species)
   not a true protein

7. Species Lactobacillus reuteri [TaxId:1598] [188444] (9 PDB entries)

8. Domain d2r6ta_: 2r6t A: [167998]
   automated match to d1rtyb_
   complexed with atp, mg

Details for d2r6ta_

PDB Entry: 2r6t, 2.61 Å

PDB Description: structure of a r132k variant pduo-type atp:co(i)rrinoid adenosyltransferase from lactobacillus reuteri complexed with atp

PDB Compounds: (A:) Cobalamin adenosyltransferase PduO-like protein

SCOPe Domain Sequences for d2r6ta_:

Sequence, based on SEQRES records:

>d2r6ta_ a.25.2.0 (A:) automated matches {Lactobacillus reuteri [TaxId: 1598]}
kiytkngdkgqtriigkqilykndprvaaygevdelnswvgytkslinshtqvlsnelee
iqqllfdcghdlatpadderhsfkfkqeqptvwleekidnytqvvpavkkfilpggtqla
salhvartitkraerqivqlmreeqinqdvlifinrlsdyffaaaryanyleqqpdmlyr

Sequence, based on observed residues (ATOM records):

>d2r6ta_ a.25.2.0 (A:) automated matches {Lactobacillus reuteri [TaxId: 1598]}
kiytkngdkgqtriigqilykndprvaaygevdelnswvgytkslinshtqvlsneleei
qqllfdcghdlatpadderhsfkfkqeqptvwleekidnytqvvpakfilpggtqlasal
hvartitkraerqivqlmreeqinqdvlifinrlsdyffaaaryanyleqqpdmlyr

Timeline for d2r6ta_:

• d2r6ta_ first appeared in SCOPe 2.01
  
• d2r6ta_ appears in SCOPe 2.07