![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) ![]() crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site |
![]() | Family a.25.2.2: Cobalamin adenosyltransferase [89032] (3 proteins) automatically mapped to Pfam PF01923 |
![]() | Protein Putative ATP-binding cobalamin adenosyltransferase YvqK [101138] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [101139] (1 PDB entry) |
![]() | Domain d1rtyb_: 1rty B: [97829] structural genomics; NESG target SR128 complexed with po4 |
PDB Entry: 1rty (more details), 2.4 Å
SCOPe Domain Sequences for d1rtyb_:
Sequence, based on SEQRES records: (download)
>d1rtyb_ a.25.2.2 (B:) Putative ATP-binding cobalamin adenosyltransferase YvqK {Bacillus subtilis [TaxId: 1423]} mklytktgdkgqtglvggrtdkdslrvesygtidelnsfiglalaelsgqpgfedltael ltiqhelfdcggdlaivterkdyklteesvsfletridaytaeapelkkfilpggskcas llhiartitrraerrvvalmkseeihetvlrylnrlsdyffagarvvnarsgigdveyer
>d1rtyb_ a.25.2.2 (B:) Putative ATP-binding cobalamin adenosyltransferase YvqK {Bacillus subtilis [TaxId: 1423]} mklytdslrvesygtidelnsfiglalaelsgqpgfedltaelltiqhelfdcggdlaiv terkdyklteesvsfletridaytaeapelkkfilpggskcasllhiartitrraerrvv almkseeihetvlrylnrlsdyffagarvvnarsgigdveyer
Timeline for d1rtyb_: