Lineage for d2qykb_ (2qyk B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1101761Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1101762Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1101839Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 1102019Protein automated matches [190370] (1 species)
    not a true protein
  7. 1102020Species Human (Homo sapiens) [TaxId:9606] [187208] (9 PDB entries)
  8. 1102025Domain d2qykb_: 2qyk B: [167885]
    automated match to d1oyna_
    complexed with mg, npv, zn

Details for d2qykb_

PDB Entry: 2qyk (more details), 2.1 Å

PDB Description: Crystal structure of PDE4A10 in complex with inhibitor NPV
PDB Compounds: (B:) Cyclic AMP-specific phosphodiesterase HSPDE4A10

SCOPe Domain Sequences for d2qykb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qykb_ a.211.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmniprfgvktdqeellaqelenlnkwglnifcvsdyaggrsltcimymifqerdllkkf
ripvdtmvtymltledhyhadvayhnslhaadvlqsthvllatpaldavftdleilaalf
aaaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqedncdifqnlskr
qrqslrkmvidmvlatdmskhmtlladlktmvetkkvtssgvllldnysdriqvlrnmvh
cadlsnptkplelyrqwtdrimaeffqqgdrerergmeispmcdkhtasveksqvgfidy
ivhplwetwadlvhpdaqeildtlednrdwyysai

SCOPe Domain Coordinates for d2qykb_:

Click to download the PDB-style file with coordinates for d2qykb_.
(The format of our PDB-style files is described here.)

Timeline for d2qykb_: