Lineage for d2qykb1 (2qyk B:290-622)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2736712Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2737088Protein automated matches [190370] (2 species)
    not a true protein
  7. 2737094Species Human (Homo sapiens) [TaxId:9606] [187208] (27 PDB entries)
  8. 2737100Domain d2qykb1: 2qyk B:290-622 [167885]
    Other proteins in same PDB: d2qyka2, d2qykb2
    automated match to d1oyna_
    complexed with mg, npv, zn

Details for d2qykb1

PDB Entry: 2qyk (more details), 2.1 Å

PDB Description: Crystal structure of PDE4A10 in complex with inhibitor NPV
PDB Compounds: (B:) Cyclic AMP-specific phosphodiesterase HSPDE4A10

SCOPe Domain Sequences for d2qykb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qykb1 a.211.1.2 (B:290-622) automated matches {Human (Homo sapiens) [TaxId: 9606]}
niprfgvktdqeellaqelenlnkwglnifcvsdyaggrsltcimymifqerdllkkfri
pvdtmvtymltledhyhadvayhnslhaadvlqsthvllatpaldavftdleilaalfaa
aihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqedncdifqnlskrqr
qslrkmvidmvlatdmskhmtlladlktmvetkkvtssgvllldnysdriqvlrnmvhca
dlsnptkplelyrqwtdrimaeffqqgdrerergmeispmcdkhtasveksqvgfidyiv
hplwetwadlvhpdaqeildtlednrdwyysai

SCOPe Domain Coordinates for d2qykb1:

Click to download the PDB-style file with coordinates for d2qykb1.
(The format of our PDB-style files is described here.)

Timeline for d2qykb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qykb2