![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
![]() | Protein Ribonucleotide reductase R2 [47257] (10 species) |
![]() | Species Escherichia coli [TaxId:562] [47258] (24 PDB entries) |
![]() | Domain d1biqb_: 1biq B: [16787] complexed with fe, fe2, hg, oh; mutant |
PDB Entry: 1biq (more details), 2.05 Å
SCOPe Domain Sequences for d1biqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1biqb_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]} ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr sfthiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardaal hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlvs
Timeline for d1biqb_: