SCOPe 2.07: Domain d2prea_: 2pre A:

Lineage for d2prea_ (2pre A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein automated matches [190264] (11 species)
   not a true protein

7. Species Tabernaemontana divaricata [TaxId:52861] [187993] (3 PDB entries)

8. Domain d2prea_: 2pre A: [167250]
   automated match to d1o0ea_
   complexed with e64, so4

Details for d2prea_

PDB Entry: 2pre, 2.7 Å

PDB Description: Crystal structure of plant cysteine protease Ervatamin-C complexed with irreversible inhibitor E-64 at 2.7 A resolution

PDB Compounds: (A:) Ervatamin-C

SCOPe Domain Sequences for d2prea_:

Sequence; same for both SEQRES and ATOM records:

>d2prea_ d.3.1.1 (A:) automated matches {Tabernaemontana divaricata [TaxId: 52861]}
lpeqidwrkkgavtpvknqgkcgscwafstvstvesinqirtgnlislseqqlvdcnkkn
hgckggafvyayqyiidnggidteanypykavqgpcraakkvvridgykgvphcnenalk
kavasqpsvvaidasskqfqhyksgifsgpcgtklnhgvvivgywkdywivrnswgrywg
eqgyirmkrvggcglcgiarlpyyptka

Timeline for d2prea_:

• d2prea_ first appeared in SCOPe 2.01
  
• d2prea_ appears in SCOPe 2.06