![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.1: Papain-like [54002] (26 proteins) |
![]() | Protein automated matches [190264] (12 species) not a true protein |
![]() | Species Tabernaemontana divaricata [TaxId:52861] [187993] (3 PDB entries) |
![]() | Domain d2prea_: 2pre A: [167250] automated match to d1o0ea_ complexed with e64, so4 |
PDB Entry: 2pre (more details), 2.7 Å
SCOPe Domain Sequences for d2prea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2prea_ d.3.1.1 (A:) automated matches {Tabernaemontana divaricata [TaxId: 52861]} lpeqidwrkkgavtpvknqgkcgscwafstvstvesinqirtgnlislseqqlvdcnkkn hgckggafvyayqyiidnggidteanypykavqgpcraakkvvridgykgvphcnenalk kavasqpsvvaidasskqfqhyksgifsgpcgtklnhgvvivgywkdywivrnswgrywg eqgyirmkrvggcglcgiarlpyyptka
Timeline for d2prea_: