PDB entry 2pre

View 2pre on RCSB PDB site
Description: Crystal structure of plant cysteine protease Ervatamin-C complexed with irreversible inhibitor E-64 at 2.7 A resolution
Class: hydrolase
Keywords: protease-inhibitor complex, papain-like fold, plant cysteine protease, Ervatamin, hydrolase
Deposited on 2007-05-04, released 2008-01-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.197
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ervatamin-C
    Species: Tabernaemontana divaricata [TaxId:52861]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2prea_
  • Chain 'B':
    Compound: Ervatamin-C
    Species: Tabernaemontana divaricata [TaxId:52861]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2preb_
  • Heterogens: SO4, E64, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2preA (A:)
    lpeqidwrkkgavtpvknqgkcgscwafstvstvesinqirtgnlislseqqlvdcnkkn
    hgckggafvyayqyiidnggidteanypykavqgpcraakkvvridgykgvphcnenalk
    kavasqpsvvaidasskqfqhyksgifsgpcgtklnhgvvivgywkdywivrnswgrywg
    eqgyirmkrvggcglcgiarlpyyptka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2preB (B:)
    lpeqidwrkkgavtpvknqgkcgscwafstvstvesinqirtgnlislseqqlvdcnkkn
    hgckggafvyayqyiidnggidteanypykavqgpcraakkvvridgykgvphcnenalk
    kavasqpsvvaidasskqfqhyksgifsgpcgtklnhgvvivgywkdywivrnswgrywg
    eqgyirmkrvggcglcgiarlpyyptka