Class a: All alpha proteins [46456] (290 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) |
Family a.211.1.1: HD domain [101340] (15 proteins) Pfam PF01966; metal dependent phosphohydrolases |
Protein 5'-nucleotidase YfbR [116969] (1 species) |
Species Escherichia coli [TaxId:562] [116970] (3 PDB entries) Uniprot P76491 Structural genomics target |
Domain d2paua_: 2pau A: [167101] automated match to d2paqa1 complexed with co, d5m, peg; mutant |
PDB Entry: 2pau (more details), 2.1 Å
SCOPe Domain Sequences for d2paua_:
Sequence, based on SEQRES records: (download)
>d2paua_ a.211.1.1 (A:) 5'-nucleotidase YfbR {Escherichia coli [TaxId: 562]} shffahlsrlklinrwplmrnvrtenvsehslqvamvahalaaiknrkfggnvnaerial lamyhdasavltgdlptpvkyfnsqiaqeykaiekiaqqklvdmvpeelrdifaplideh aysdeekslvkqadalcaylkcleelaagnnefllaktrleatlearrsqemdyfmeifv psf
>d2paua_ a.211.1.1 (A:) 5'-nucleotidase YfbR {Escherichia coli [TaxId: 562]} shffahlsrlklinrwplmrnvrtenvsehslqvamvahalaaiknrkfggnvnaerial lamyhdasavltgdlptpiaqeykaiekiaqqklvdmvpeelrdifaplidehaysdeek slvkqadalcaylkcleelaagnnefllaktrleatlearrsqemdyfmeifvpsf
Timeline for d2paua_: