PDB entry 2pau

View 2pau on RCSB PDB site
Description: Crystal structure of the 5'-deoxynucleotidase YfbR mutant E72A complexed with Co(2+) and dAMP
Class: hydrolase
Keywords: Nucleotidase, 5'-deoxynucleotidase, YfbR, HD domain phosphohydrolase, HYDROLASE
Deposited on 2007-03-27, released 2008-03-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.196
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-deoxynucleotidase YfbR
    Species: Escherichia coli [TaxId:83333]
    Gene: yfbR, b2291, JW2288
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76491
      • engineered (73)
    Domains in SCOPe 2.08: d2paua_
  • Chain 'B':
    Compound: 5'-deoxynucleotidase YfbR
    Species: Escherichia coli [TaxId:83333]
    Gene: yfbR, b2291, JW2288
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76491
      • engineered (73)
    Domains in SCOPe 2.08: d2paub_
  • Heterogens: CO, D5M, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pauA (A:)
    ghmkqshffahlsrlklinrwplmrnvrtenvsehslqvamvahalaaiknrkfggnvna
    eriallamyhdasavltgdlptpvkyfnsqiaqeykaiekiaqqklvdmvpeelrdifap
    lidehaysdeekslvkqadalcaylkcleelaagnnefllaktrleatlearrsqemdyf
    meifvpsfhlsldeisqdspl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pauA (A:)
    shffahlsrlklinrwplmrnvrtenvsehslqvamvahalaaiknrkfggnvnaerial
    lamyhdasavltgdlptpiaqeykaiekiaqqklvdmvpeelrdifaplidehaysdeek
    slvkqadalcaylkcleelaagnnefllaktrleatlearrsqemdyfmeifvpsf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pauB (B:)
    ghmkqshffahlsrlklinrwplmrnvrtenvsehslqvamvahalaaiknrkfggnvna
    eriallamyhdasavltgdlptpvkyfnsqiaqeykaiekiaqqklvdmvpeelrdifap
    lidehaysdeekslvkqadalcaylkcleelaagnnefllaktrleatlearrsqemdyf
    meifvpsfhlsldeisqdspl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pauB (B:)
    kqshffahlsrlklinrwplmrnvrtenvsehslqvamvahalaaiknrkfggnvnaeri
    allamyhdasavltgdlptpaqeykaiekiaqqklvdmvpeelrdifaplidehaysdee
    kslvkqadalcaylkcleelaagnnefllaktrleatlearrsqemdyfmeifvpsf