Lineage for d2para_ (2par A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1508295Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1508296Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1508297Family a.211.1.1: HD domain [101340] (14 proteins)
    Pfam PF01966; metal dependent phosphohydrolases
  6. 1508298Protein 5'-nucleotidase YfbR [116969] (1 species)
  7. 1508299Species Escherichia coli [TaxId:562] [116970] (3 PDB entries)
    Uniprot P76491
    Structural genomics target
  8. 1508300Domain d2para_: 2par A: [167099]
    automated match to d2paqa1
    complexed with co, peg, tmp; mutant

Details for d2para_

PDB Entry: 2par (more details), 2.1 Å

PDB Description: crystal structure of the 5'-deoxynucleotidase yfbr mutant e72a complexed with co(2+) and tmp
PDB Compounds: (A:) 5'-deoxynucleotidase YfbR

SCOPe Domain Sequences for d2para_:

Sequence, based on SEQRES records: (download)

>d2para_ a.211.1.1 (A:) 5'-nucleotidase YfbR {Escherichia coli [TaxId: 562]}
kqshffahlsrlklinrwplmrnvrtenvsehslqvamvahalaaiknrkfggnvnaeri
allamyhdasavltgdlptpvkyfnsqiaqeykaiekiaqqklvdmvpeelrdifaplid
ehaysdeekslvkqadalcaylkcleelaagnnefllaktrleatlearrsqemdyfmei
fvpsfh

Sequence, based on observed residues (ATOM records): (download)

>d2para_ a.211.1.1 (A:) 5'-nucleotidase YfbR {Escherichia coli [TaxId: 562]}
kqshffahlsrlklinrwplmrnvrtenvsehslqvamvahalaaiknrkfggnvnaeri
allamyhdasavltgdlpteykaiekiaqqklvdmvpeelrdifaplidehaysdeeksl
vkqadalcaylkcleelaagnnefllaktrleatlearrsqemdyfmeifvpsfh

SCOPe Domain Coordinates for d2para_:

Click to download the PDB-style file with coordinates for d2para_.
(The format of our PDB-style files is described here.)

Timeline for d2para_: