SCOPe 2.08: Domain d2para_: 2par A:

Lineage for d2para_ (2par A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.1: HD domain [101340] (15 proteins)
   Pfam PF01966; metal dependent phosphohydrolases

6. Protein 5'-nucleotidase YfbR [116969] (1 species)

7. Species Escherichia coli [TaxId:562] [116970] (3 PDB entries)
   Uniprot P76491
   Structural genomics target

8. Domain d2para_: 2par A: [167099]
   automated match to d2paqa1
   complexed with co, peg, tmp; mutant

Details for d2para_

PDB Entry: 2par, 2.1 Å

PDB Description: crystal structure of the 5'-deoxynucleotidase yfbr mutant e72a complexed with co(2+) and tmp

PDB Compounds: (A:) 5'-deoxynucleotidase YfbR

SCOPe Domain Sequences for d2para_:

Sequence, based on SEQRES records:

>d2para_ a.211.1.1 (A:) 5'-nucleotidase YfbR {Escherichia coli [TaxId: 562]}
kqshffahlsrlklinrwplmrnvrtenvsehslqvamvahalaaiknrkfggnvnaeri
allamyhdasavltgdlptpvkyfnsqiaqeykaiekiaqqklvdmvpeelrdifaplid
ehaysdeekslvkqadalcaylkcleelaagnnefllaktrleatlearrsqemdyfmei
fvpsfh

Sequence, based on observed residues (ATOM records):

>d2para_ a.211.1.1 (A:) 5'-nucleotidase YfbR {Escherichia coli [TaxId: 562]}
kqshffahlsrlklinrwplmrnvrtenvsehslqvamvahalaaiknrkfggnvnaeri
allamyhdasavltgdlpteykaiekiaqqklvdmvpeelrdifaplidehaysdeeksl
vkqadalcaylkcleelaagnnefllaktrleatlearrsqemdyfmeifvpsfh

Timeline for d2para_:

• d2para_ first appeared in SCOPe 2.01
  
• d2para_ appears in SCOPe 2.07