Lineage for d2paqa1 (2paq A:2-187)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
multihelical; consists of two different alpha-helical bundlesSuperfamily a.211.1: HD-domain/PDEase-like [109604] (5 families) 
Family a.211.1.1: HD domain [101340] (13 proteins)
Pfam PF01966; metal dependent phosphohydrolases
Protein 5'-nucleotidase YfbR [116969] (1 species) Species Escherichia coli [TaxId:562] [116970] (1 PDB entry)
Uniprot P76491
Structural genomics target
Domain d2paqa1: 2paq A:2-187 [139643]
automatically matched to d1wpha_
Details for d2paqa1
PDB Entry: 2paq (more details), 2.1 Å
PDB Description: crystal structure of the 5'-deoxynucleotidase yfbr
PDB Compounds: (A:) 5'-deoxynucleotidase YfbRSCOP Domain Sequences for d2paqa1:
Sequence, based on SEQRES records: (download)
>d2paqa1 a.211.1.1 (A:2-187) 5'-nucleotidase YfbR {Escherichia coli [TaxId: 562]}
kqshffahlsrlklinrwplmrnvrtenvsehslqvamvahalaaiknrkfggnvnaeri
allamyhdasevltgdlptpvkyfnsqiaqeykaiekiaqqklvdmvpeelrdifaplid
ehaysdeekslvkqadalcaylkcleelaagnnefllaktrleatlearrsqemdyfmei
fvpsfh
Sequence, based on observed residues (ATOM records): (download)
>d2paqa1 a.211.1.1 (A:2-187) 5'-nucleotidase YfbR {Escherichia coli [TaxId: 562]}
kqshffahlsrlklinrwplmrnvrtenvsehslqvamvahalaaiknrkfggnvnaeri
allamyhdasevltgdlptpqeykaiekiaqqklvdmvpeelrdifaplidehaysdeek
slvkqadalcaylkcleelaagnnefllaktrleatlearrsqemdyfmeifvpsfh
SCOP Domain Coordinates for d2paqa1:
Click to download the PDB-style file with coordinates for d2paqa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2paqa1:
- d2paqa1 first appeared in SCOP 1.73
- d2paqa1 is called d2paqa_ in SCOPe 2.01
- d2paqa1 appears in the current release, SCOPe 2.08, called d2paqa_
View in 3D
