SCOPe 2.08: Domain d1avo.5: 1avo I:,J:

Lineage for d1avo.5 (1avo I:,J:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.8: Proteasome activator [47216] (1 family)

5. Family a.24.8.1: Proteasome activator [47217] (3 proteins)

6. Protein Proteasome activator reg(alpha) [47218] (1 species)
   The structure of the proteasome complex with this protein from (Trypanosoma brucei) is available (1fnt); however, PDB entry 1FNT designates protein chains by both upper case and lower case letters creating problems with its processing and presentation; the proteasome activator pa26 chains are designated by lower case letters (c;d;e;f;g;h;i;j;k;l;m;n;o;p)

7. Species Human (Homo sapiens) [TaxId:9606] [47219] (1 PDB entry)

8. Domain d1avo.5: 1avo I:,J: [16623]

Details for d1avo.5

PDB Entry: 1avo, 2.8 Å

PDB Description: proteasome activator reg(alpha)

PDB Compounds: (I:) 11s regulator, (J:) 11s regulator

SCOPe Domain Sequences for d1avo.5:

Sequence; same for both SEQRES and ATOM records:

>g1avo.5 a.24.8.1 (I:,J:) Proteasome activator reg(alpha) {Human (Homo sapiens) [TaxId: 9606]}
lrvqpeaqakvdvfredlctktenllgsyfpkkiseldaflkepalneanlsnlkapldi
Xavncnekivvllqrlkpeikdvieqlnlvttwlqlqipriedgnnfgvavqekvfelmt
slhtklegfhtqiskyfsergdavtkaakqphvgdyrqlvheldeaeyrdirlmvmeirn
ayavlydiilknfeklkkprg

Timeline for d1avo.5:

• d1avo.5 first appeared (with stable ids) in SCOP 1.55
  
• d1avo.5 appears in SCOPe 2.07