PDB entry 1avo

View 1avo on RCSB PDB site
Description: proteasome activator reg(alpha)
Class: proteasome activator
Keywords: proteasome activator, cell adhesion, interferon induction
Deposited on 1997-09-18, released 1997-12-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.249
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 11s regulator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1avo.1
  • Chain 'B':
    Compound: 11s regulator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1avo.1
  • Chain 'C':
    Compound: 11s regulator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1avo.2
  • Chain 'D':
    Compound: 11s regulator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1avo.2
  • Chain 'E':
    Compound: 11s regulator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1avo.3
  • Chain 'F':
    Compound: 11s regulator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1avo.3
  • Chain 'G':
    Compound: 11s regulator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1avo.4
  • Chain 'H':
    Compound: 11s regulator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1avo.4
  • Chain 'I':
    Compound: 11s regulator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1avo.5
  • Chain 'J':
    Compound: 11s regulator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1avo.5
  • Chain 'K':
    Compound: 11s regulator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1avo.6
  • Chain 'L':
    Compound: 11s regulator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1avo.6
  • Chain 'M':
    Compound: 11s regulator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1avo.7
  • Chain 'N':
    Compound: 11s regulator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1avo.7

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avoA (A:)
    lrvqpeaqakvdvfredlctktenllgsyfpkkiseldaflkepalneanlsnlkapldi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avoB (B:)
    avncnekivvllqrlkpeikdvieqlnlvttwlqlqipriedgnnfgvavqekvfelmts
    lhtklegfhtqiskyfsergdavtkaakqphvgdyrqlvheldeaeyrdirlmvmeirna
    yavlydiilknfeklkkprg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avoC (C:)
    lrvqpeaqakvdvfredlctktenllgsyfpkkiseldaflkepalneanlsnlkapldi
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avoD (D:)
    avncnekivvllqrlkpeikdvieqlnlvttwlqlqipriedgnnfgvavqekvfelmts
    lhtklegfhtqiskyfsergdavtkaakqphvgdyrqlvheldeaeyrdirlmvmeirna
    yavlydiilknfeklkkprg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avoE (E:)
    lrvqpeaqakvdvfredlctktenllgsyfpkkiseldaflkepalneanlsnlkapldi
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avoF (F:)
    avncnekivvllqrlkpeikdvieqlnlvttwlqlqipriedgnnfgvavqekvfelmts
    lhtklegfhtqiskyfsergdavtkaakqphvgdyrqlvheldeaeyrdirlmvmeirna
    yavlydiilknfeklkkprg
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avoG (G:)
    lrvqpeaqakvdvfredlctktenllgsyfpkkiseldaflkepalneanlsnlkapldi
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avoH (H:)
    avncnekivvllqrlkpeikdvieqlnlvttwlqlqipriedgnnfgvavqekvfelmts
    lhtklegfhtqiskyfsergdavtkaakqphvgdyrqlvheldeaeyrdirlmvmeirna
    yavlydiilknfeklkkprg
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avoI (I:)
    lrvqpeaqakvdvfredlctktenllgsyfpkkiseldaflkepalneanlsnlkapldi
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avoJ (J:)
    avncnekivvllqrlkpeikdvieqlnlvttwlqlqipriedgnnfgvavqekvfelmts
    lhtklegfhtqiskyfsergdavtkaakqphvgdyrqlvheldeaeyrdirlmvmeirna
    yavlydiilknfeklkkprg
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avoK (K:)
    lrvqpeaqakvdvfredlctktenllgsyfpkkiseldaflkepalneanlsnlkapldi
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avoL (L:)
    avncnekivvllqrlkpeikdvieqlnlvttwlqlqipriedgnnfgvavqekvfelmts
    lhtklegfhtqiskyfsergdavtkaakqphvgdyrqlvheldeaeyrdirlmvmeirna
    yavlydiilknfeklkkprg
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avoM (M:)
    lrvqpeaqakvdvfredlctktenllgsyfpkkiseldaflkepalneanlsnlkapldi
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avoN (N:)
    avncnekivvllqrlkpeikdvieqlnlvttwlqlqipriedgnnfgvavqekvfelmts
    lhtklegfhtqiskyfsergdavtkaakqphvgdyrqlvheldeaeyrdirlmvmeirna
    yavlydiilknfeklkkprg