![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
![]() | Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) ![]() the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
![]() | Family c.73.1.0: automated matches [191466] (1 protein) not a true family |
![]() | Protein automated matches [190728] (15 species) not a true protein |
![]() | Species Bacillus anthracis [TaxId:198094] [188502] (1 PDB entry) |
![]() | Domain d2jjxc_: 2jjx C: [166227] automated match to d2bnda1 complexed with atp, mg |
PDB Entry: 2jjx (more details), 2.82 Å
SCOPe Domain Sequences for d2jjxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jjxc_ c.73.1.0 (C:) automated matches {Bacillus anthracis [TaxId: 198094]} rpykrvliklsggaladqtgnsfnskrlehianeilsivdlgievsivigggnifrghla eewgidrveadnigtlgtiinslmlrgvltsktnkevrvmtsipfnavaepyirlravhh ldngyivifgggngqpfvttdypsvqraiemnsdailvakqgvdgvftsdpkhnksakmy rklnyndvvrqniqvmdqaalllardynlpahvfnfdepgvmrriclgehvgtlinddas llvh
Timeline for d2jjxc_: