SCOPe 2.07: Domain d2jjxb_: 2jjx B:

Lineage for d2jjxb_ (2jjx B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.0: automated matches [191466] (1 protein)
   not a true family

6. Protein automated matches [190728] (15 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:198094] [188502] (1 PDB entry)

8. Domain d2jjxb_: 2jjx B: [166226]
   automated match to d2bnda1
   complexed with atp, mg

Details for d2jjxb_

PDB Entry: 2jjx, 2.82 Å

PDB Description: the crystal structure of ump kinase from bacillus anthracis (ba1797)

PDB Compounds: (B:) uridylate kinase

SCOPe Domain Sequences for d2jjxb_:

Sequence; same for both SEQRES and ATOM records:

>d2jjxb_ c.73.1.0 (B:) automated matches {Bacillus anthracis [TaxId: 198094]}
rpykrvliklsggaladqtgnsfnskrlehianeilsivdlgievsivigggnifrghla
eewgidrveadnigtlgtiinslmlrgvltsktnkevrvmtsipfnavaepyirlravhh
ldngyivifgggngqpfvttdypsvqraiemnsdailvakqgvdgvftsdpkhnksakmy
rklnyndvvrqniqvmdqaalllardynlpahvfnfdepgvmrriclgehvgtlinddas
llvh

Timeline for d2jjxb_:

• d2jjxb_ first appeared in SCOPe 2.01
  
• d2jjxb_ appears in SCOPe 2.06