Lineage for d2jjxb_ (2jjx B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905127Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2905128Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2905281Family c.73.1.0: automated matches [191466] (1 protein)
    not a true family
  6. 2905282Protein automated matches [190728] (15 species)
    not a true protein
  7. 2905356Species Bacillus anthracis [TaxId:198094] [188502] (1 PDB entry)
  8. 2905358Domain d2jjxb_: 2jjx B: [166226]
    automated match to d2bnda1
    complexed with atp, mg

Details for d2jjxb_

PDB Entry: 2jjx (more details), 2.82 Å

PDB Description: the crystal structure of ump kinase from bacillus anthracis (ba1797)
PDB Compounds: (B:) uridylate kinase

SCOPe Domain Sequences for d2jjxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jjxb_ c.73.1.0 (B:) automated matches {Bacillus anthracis [TaxId: 198094]}
rpykrvliklsggaladqtgnsfnskrlehianeilsivdlgievsivigggnifrghla
eewgidrveadnigtlgtiinslmlrgvltsktnkevrvmtsipfnavaepyirlravhh
ldngyivifgggngqpfvttdypsvqraiemnsdailvakqgvdgvftsdpkhnksakmy
rklnyndvvrqniqvmdqaalllardynlpahvfnfdepgvmrriclgehvgtlinddas
llvh

SCOPe Domain Coordinates for d2jjxb_:

Click to download the PDB-style file with coordinates for d2jjxb_.
(The format of our PDB-style files is described here.)

Timeline for d2jjxb_: