SCOPe 2.08: Domain d1nsgb_: 1nsg B:

Lineage for d1nsgb_ (1nsg B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.7: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47212] (1 family)
   automatically mapped to Pfam PF08771

5. Family a.24.7.1: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47213] (2 proteins)

6. Protein mTOR FKBP12–rapamycin-binding (FRB) domain [47214] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47215] (11 PDB entries)

8. Domain d1nsgb_: 1nsg B: [16613]
   Other proteins in same PDB: d1nsga_
   complexed with rad

Details for d1nsgb_

PDB Entry: 1nsg, 2.2 Å

PDB Description: the structure of the immunophilin-immunosuppressant fkbp12-rapamycin complex interacting with human frap

PDB Compounds: (B:) fkbp-rapamycin associated protein (frap)

SCOPe Domain Sequences for d1nsgb_:

Sequence; same for both SEQRES and ATOM records:

>d1nsgb_ a.24.7.1 (B:) mTOR FKBP12–rapamycin-binding (FRB) domain {Human (Homo sapiens) [TaxId: 9606]}
vailwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrdl
meaqewcrkymksgnvkdltqawdlyyhvfrris

Timeline for d1nsgb_:

• d1nsgb_ first appeared (with stable ids) in SCOP 1.55
  
• d1nsgb_ appears in SCOPe 2.07