Lineage for d2j6wb_ (2j6w B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 938438Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 938790Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 939015Family b.2.5.6: RUNT domain [81318] (2 proteins)
  6. 939041Protein automated matches [190872] (1 species)
    not a true protein
  7. 939042Species Mouse (Mus musculus) [TaxId:10090] [188223] (1 PDB entry)
  8. 939044Domain d2j6wb_: 2j6w B: [165918]
    automated match to d1cmoa_
    complexed with cl; mutant

Details for d2j6wb_

PDB Entry: 2j6w (more details), 2.6 Å

PDB Description: r164n mutant of the runx1 runt domain
PDB Compounds: (B:) runt-related transcription factor 1

SCOPe Domain Sequences for d2j6wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j6wb_ b.2.5.6 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
smvevladhpgelvrtdspnflssvlpthwrsnktlpiafkvvalgdvpdgtlvtvmagn
denysaelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhnaikit
vdgp

SCOPe Domain Coordinates for d2j6wb_:

Click to download the PDB-style file with coordinates for d2j6wb_.
(The format of our PDB-style files is described here.)

Timeline for d2j6wb_: