| Class b: All beta proteins [48724] (174 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (7 families) ![]() |
| Family b.2.5.6: RUNT domain [81318] (2 proteins) |
| Protein automated matches [190872] (1 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188223] (1 PDB entry) |
| Domain d2j6wa_: 2j6w A: [165917] automated match to d1cmoa_ complexed with cl; mutant |
PDB Entry: 2j6w (more details), 2.6 Å
SCOPe Domain Sequences for d2j6wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j6wa_ b.2.5.6 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
smvevladhpgelvrtdspnflssvlpthwrsnktlpiafkvvalgdvpdgtlvtvmagn
denysaelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhnaikit
vdgp
Timeline for d2j6wa_: