Lineage for d2j5gg_ (2j5g G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2854121Species Nostoc sp. PCC 7120 [TaxId:103690] [187895] (2 PDB entries)
  8. 2854128Domain d2j5gg_: 2j5g G: [165905]
    automated match to d1o8ua_
    complexed with so4

Details for d2j5gg_

PDB Entry: 2j5g (more details), 1.46 Å

PDB Description: the native structure of a beta-diketone hydrolase from the cyanobacterium anabaena sp. pcc 7120
PDB Compounds: (G:) alr4455 protein

SCOPe Domain Sequences for d2j5gg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j5gg_ c.14.1.0 (G:) automated matches {Nostoc sp. PCC 7120 [TaxId: 103690]}
qpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdafydisrdrdnrvvil
tgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpvisavngaallhsey
ilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgryflftqekltaqqay
elnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkrlvnegigyglaleg
itatdlrnt

SCOPe Domain Coordinates for d2j5gg_:

Click to download the PDB-style file with coordinates for d2j5gg_.
(The format of our PDB-style files is described here.)

Timeline for d2j5gg_: