PDB entry 2j5g

View 2j5g on RCSB PDB site
Description: the native structure of a beta-diketone hydrolase from the cyanobacterium anabaena sp. pcc 7120
Class: hydrolase
Keywords: enzyme evolution, c-c bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone
Deposited on 2006-09-18, released 2007-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.151
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alr4455 protein
    Species: ANABAENA SP. [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J5G
      • conflict (262)
    • Uniprot Q8YNV6 (Start-262)
    Domains in SCOPe 2.07: d2j5ga_
  • Chain 'B':
    Compound: alr4455 protein
    Species: ANABAENA SP. [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J5G
      • conflict (262)
    • Uniprot Q8YNV6 (Start-262)
    Domains in SCOPe 2.07: d2j5gb_
  • Chain 'C':
    Compound: alr4455 protein
    Species: ANABAENA SP. [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J5G
      • conflict (262)
    • Uniprot Q8YNV6 (Start-262)
    Domains in SCOPe 2.07: d2j5gc_
  • Chain 'D':
    Compound: alr4455 protein
    Species: ANABAENA SP. [TaxId:103690]
    Domains in SCOPe 2.07: d2j5gd_
  • Chain 'E':
    Compound: alr4455 protein
    Species: ANABAENA SP. [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J5G
      • conflict (262)
    • Uniprot Q8YNV6 (Start-262)
    Domains in SCOPe 2.07: d2j5ge_
  • Chain 'F':
    Compound: alr4455 protein
    Species: ANABAENA SP. [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J5G
      • conflict (262)
    • Uniprot Q8YNV6 (Start-262)
    Domains in SCOPe 2.07: d2j5gf_
  • Chain 'G':
    Compound: alr4455 protein
    Species: ANABAENA SP. [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J5G
      • conflict (262)
    • Uniprot Q8YNV6 (Start-262)
    Domains in SCOPe 2.07: d2j5gg_
  • Chain 'H':
    Compound: alr4455 protein
    Species: ANABAENA SP. [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J5G
      • conflict (262)
    • Uniprot Q8YNV6 (Start-262)
    Domains in SCOPe 2.07: d2j5gh_
  • Chain 'I':
    Compound: alr4455 protein
    Species: ANABAENA SP. [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J5G
      • conflict (262)
    • Uniprot Q8YNV6 (Start-262)
    Domains in SCOPe 2.07: d2j5gi_
  • Chain 'J':
    Compound: alr4455 protein
    Species: ANABAENA SP. [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J5G
      • conflict (262)
    • Uniprot Q8YNV6 (Start-262)
    Domains in SCOPe 2.07: d2j5gj_
  • Chain 'K':
    Compound: alr4455 protein
    Species: ANABAENA SP. [TaxId:103690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j5gk_
  • Chain 'L':
    Compound: alr4455 protein
    Species: ANABAENA SP. [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J5G
      • conflict (262)
    • Uniprot Q8YNV6 (Start-262)
    Domains in SCOPe 2.07: d2j5gl_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j5gA (A:)
    mgsshhhhhhmtlnqpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdaf
    ydisrdrdnrvviltgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpv
    isavngaallhseyilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgry
    flftqekltaqqayelnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkr
    lvnegigyglalegitatdlrnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5gA (A:)
    qpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdafydisrdrdnrvvil
    tgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpvisavngaallhsey
    ilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgryflftqekltaqqay
    elnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkrlvnegigyglaleg
    itatdlrnt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j5gB (B:)
    mgsshhhhhhmtlnqpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdaf
    ydisrdrdnrvviltgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpv
    isavngaallhseyilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgry
    flftqekltaqqayelnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkr
    lvnegigyglalegitatdlrnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5gB (B:)
    nqpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdafydisrdrdnrvvi
    ltgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpvisavngaallhse
    yilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgryflftqekltaqqa
    yelnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkrlvnegigyglale
    gitatdlrnt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2j5gC (C:)
    mgsshhhhhhmtlnqpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdaf
    ydisrdrdnrvviltgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpv
    isavngaallhseyilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgry
    flftqekltaqqayelnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkr
    lvnegigyglalegitatdlrnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5gC (C:)
    qpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdafydisrdrdnrvvil
    tgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpvisavngaallhsey
    ilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgryflftqekltaqqay
    elnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkrlvnegigyglaleg
    itatdlrnt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2j5gD (D:)
    mgsshhhhhhmtlnqpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdaf
    ydisrdrdnrvviltgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpv
    isavngaallhseyilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgry
    flftqekltaqqayelnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkr
    lvnegigyglalegitatdlrnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5gD (D:)
    qpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdafydisrdrdnrvvil
    tgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpvisavngaallhsey
    ilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgryflftqekltaqqay
    elnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkrlvnegigyglaleg
    itatdlrnn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2j5gE (E:)
    mgsshhhhhhmtlnqpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdaf
    ydisrdrdnrvviltgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpv
    isavngaallhseyilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgry
    flftqekltaqqayelnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkr
    lvnegigyglalegitatdlrnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5gE (E:)
    qpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdafydisrdrdnrvvil
    tgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpvisavngaallhsey
    ilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgryflftqekltaqqay
    elnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkrlvnegigyglaleg
    itatdlrnt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2j5gF (F:)
    mgsshhhhhhmtlnqpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdaf
    ydisrdrdnrvviltgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpv
    isavngaallhseyilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgry
    flftqekltaqqayelnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkr
    lvnegigyglalegitatdlrnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5gF (F:)
    qpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdafydisrdrdnrvvil
    tgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpvisavngaallhsey
    ilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgryflftqekltaqqay
    elnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkrlvnegigyglaleg
    itatdlrnt
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2j5gG (G:)
    mgsshhhhhhmtlnqpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdaf
    ydisrdrdnrvviltgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpv
    isavngaallhseyilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgry
    flftqekltaqqayelnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkr
    lvnegigyglalegitatdlrnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5gG (G:)
    qpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdafydisrdrdnrvvil
    tgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpvisavngaallhsey
    ilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgryflftqekltaqqay
    elnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkrlvnegigyglaleg
    itatdlrnt
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2j5gH (H:)
    mgsshhhhhhmtlnqpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdaf
    ydisrdrdnrvviltgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpv
    isavngaallhseyilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgry
    flftqekltaqqayelnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkr
    lvnegigyglalegitatdlrnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5gH (H:)
    qpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdafydisrdrdnrvvil
    tgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpvisavngaallhsey
    ilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgryflftqekltaqqay
    elnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkrlvnegigyglaleg
    itatdlrnt
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2j5gI (I:)
    mgsshhhhhhmtlnqpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdaf
    ydisrdrdnrvviltgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpv
    isavngaallhseyilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgry
    flftqekltaqqayelnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkr
    lvnegigyglalegitatdlrnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5gI (I:)
    qpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdafydisrdrdnrvvil
    tgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpvisavngaallhsey
    ilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgryflftqekltaqqay
    elnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkrlvnegigyglaleg
    itatdlrnt
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2j5gJ (J:)
    mgsshhhhhhmtlnqpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdaf
    ydisrdrdnrvviltgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpv
    isavngaallhseyilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgry
    flftqekltaqqayelnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkr
    lvnegigyglalegitatdlrnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5gJ (J:)
    qpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdafydisrdrdnrvvil
    tgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpvisavngaallhsey
    ilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgryflftqekltaqqay
    elnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkrlvnegigyglaleg
    itatdlrnt
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2j5gK (K:)
    mgsshhhhhhmtlnqpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdaf
    ydisrdrdnrvviltgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpv
    isavngaallhseyilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgry
    flftqekltaqqayelnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkr
    lvnegigyglalegitatdlrnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5gK (K:)
    qpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdafydisrdrdnrvvil
    tgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpvisavngaallhsey
    ilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgryflftqekltaqqay
    elnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkrlvnegigyglaleg
    itatdlrn
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2j5gL (L:)
    mgsshhhhhhmtlnqpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdaf
    ydisrdrdnrvviltgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpv
    isavngaallhseyilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgry
    flftqekltaqqayelnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkr
    lvnegigyglalegitatdlrnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5gL (L:)
    qpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdafydisrdrdnrvvil
    tgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpvisavngaallhsey
    ilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgryflftqekltaqqay
    elnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkrlvnegigyglaleg
    itatdlrnt