Lineage for d2j5gi_ (2j5g I:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (54 species)
    not a true protein
  7. 2100447Species Nostoc sp. PCC 7120 [TaxId:103690] [187895] (2 PDB entries)
  8. 2100456Domain d2j5gi_: 2j5g I: [165907]
    automated match to d1o8ua_
    complexed with so4

Details for d2j5gi_

PDB Entry: 2j5g (more details), 1.46 Å

PDB Description: the native structure of a beta-diketone hydrolase from the cyanobacterium anabaena sp. pcc 7120
PDB Compounds: (I:) alr4455 protein

SCOPe Domain Sequences for d2j5gi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j5gi_ c.14.1.0 (I:) automated matches {Nostoc sp. PCC 7120 [TaxId: 103690]}
qpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdafydisrdrdnrvvil
tgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpvisavngaallhsey
ilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgryflftqekltaqqay
elnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkrlvnegigyglaleg
itatdlrnt

SCOPe Domain Coordinates for d2j5gi_:

Click to download the PDB-style file with coordinates for d2j5gi_.
(The format of our PDB-style files is described here.)

Timeline for d2j5gi_: