Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (10 species) not a true protein |
Species Nostoc sp. PCC 7120 [TaxId:103690] [187895] (2 PDB entries) |
Domain d2j5gg_: 2j5g G: [165905] automated match to d1o8ua_ complexed with so4 |
PDB Entry: 2j5g (more details), 1.46 Å
SCOPe Domain Sequences for d2j5gg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j5gg_ c.14.1.0 (G:) automated matches {Nostoc sp. PCC 7120 [TaxId: 103690]} qpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdafydisrdrdnrvvil tgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpvisavngaallhsey ilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgryflftqekltaqqay elnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkrlvnegigyglaleg itatdlrnt
Timeline for d2j5gg_: