SCOPe 2.04: Domain d2i9da_: 2i9d A:

Lineage for d2i9da_ (2i9d A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families)

5. Family c.43.1.0: automated matches [191456] (1 protein)
   not a true family

6. Protein automated matches [190703] (5 species)
   not a true protein

7. Species Bacteroides thetaiotaomicron [TaxId:226186] [187847] (1 PDB entry)

8. Domain d2i9da_: 2i9d A: [165444]
   automated match to d1qcaa_

Details for d2i9da_

PDB Entry: 2i9d, 2.3 Å

PDB Description: chloramphenicol acetyltransferase

PDB Compounds: (A:) Chloramphenicol acetyltransferase

SCOPe Domain Sequences for d2i9da_:

Sequence; same for both SEQRES and ATOM records:

>d2i9da_ c.43.1.0 (A:) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
mkqiidienwerkenfnffrhfqnpqlsitsevecggarqrakaagqsfflhylyavlra
aneipefryridpdgrvvlydtidmlspikikengkffttrfpyhndfdtfyqearliid
aipedgdpyaaeneevadgdyglillsatpdlyftsitgtqekrsgnnypllnagkaiir
egrlvmpiamtihhgfidghhlslfykkvedflk

Timeline for d2i9da_:

• d2i9da_ first appeared in SCOPe 2.01
  
• d2i9da_ appears in SCOPe 2.03
  
• d2i9da_ appears in SCOPe 2.05
  
• d2i9da_ appears in the current release, SCOPe 2.08