Lineage for d2i9da_ (2i9d A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991328Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 991329Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families) (S)
  5. 991470Family c.43.1.0: automated matches [191456] (1 protein)
    not a true family
  6. 991471Protein automated matches [190703] (2 species)
    not a true protein
  7. 991472Species Bacteroides thetaiotaomicron [TaxId:226186] [187847] (1 PDB entry)
  8. 991473Domain d2i9da_: 2i9d A: [165444]
    automated match to d1qcaa_

Details for d2i9da_

PDB Entry: 2i9d (more details), 2.3 Å

PDB Description: chloramphenicol acetyltransferase
PDB Compounds: (A:) Chloramphenicol acetyltransferase

SCOPe Domain Sequences for d2i9da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i9da_ c.43.1.0 (A:) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
mkqiidienwerkenfnffrhfqnpqlsitsevecggarqrakaagqsfflhylyavlra
aneipefryridpdgrvvlydtidmlspikikengkffttrfpyhndfdtfyqearliid
aipedgdpyaaeneevadgdyglillsatpdlyftsitgtqekrsgnnypllnagkaiir
egrlvmpiamtihhgfidghhlslfykkvedflk

SCOPe Domain Coordinates for d2i9da_:

Click to download the PDB-style file with coordinates for d2i9da_.
(The format of our PDB-style files is described here.)

Timeline for d2i9da_: