| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily) core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest |
Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) ![]() |
| Family c.43.1.0: automated matches [191456] (1 protein) not a true family |
| Protein automated matches [190703] (7 species) not a true protein |
| Species Bacteroides thetaiotaomicron [TaxId:226186] [187847] (1 PDB entry) |
| Domain d2i9da_: 2i9d A: [165444] Other proteins in same PDB: d2i9db2, d2i9dc2 automated match to d1qcaa_ |
PDB Entry: 2i9d (more details), 2.3 Å
SCOPe Domain Sequences for d2i9da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i9da_ c.43.1.0 (A:) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
mkqiidienwerkenfnffrhfqnpqlsitsevecggarqrakaagqsfflhylyavlra
aneipefryridpdgrvvlydtidmlspikikengkffttrfpyhndfdtfyqearliid
aipedgdpyaaeneevadgdyglillsatpdlyftsitgtqekrsgnnypllnagkaiir
egrlvmpiamtihhgfidghhlslfykkvedflk
Timeline for d2i9da_:
View in 3DDomains from other chains: (mouse over for more information) d2i9db1, d2i9db2, d2i9dc1, d2i9dc2 |