SCOPe 2.07: Domain d2i0lb_: 2i0l B:

Lineage for d2i0lb_ (2i0l B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (6 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186775] (10 PDB entries)

8. Domain d2i0lb_: 2i0l B: [165357]
   automated match to d1qlca_

Details for d2i0lb_

PDB Entry: 2i0l, 2.31 Å

PDB Description: X-ray crystal structure of Sap97 PDZ2 bound to the C-terminal peptide of HPV18 E6.

PDB Compounds: (B:) Disks large homolog 1

SCOPe Domain Sequences for d2i0lb_:

Sequence; same for both SEQRES and ATOM records:

>d2i0lb_ b.36.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgklqigdkllavnsvc
leevtheeavtalkntsdfvylk

Timeline for d2i0lb_:

• d2i0lb_ first appeared in SCOPe 2.01
  
• d2i0lb_ appears in SCOPe 2.06
  
• d2i0lb_ appears in the current release, SCOPe 2.08