PDB entry 2i0l

View 2i0l on RCSB PDB site
Description: X-ray crystal structure of Sap97 PDZ2 bound to the C-terminal peptide of HPV18 E6.
Class: peptide binding protein
Keywords: SAP97 PDZ2, HPV18 E6, tumor suppressor, carcinoma, PEPTIDE BINDING PROTEIN
Deposited on 2006-08-10, released 2007-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-09-23, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.239
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Disks large homolog 1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2i0la_
  • Chain 'B':
    Compound: Disks large homolog 1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2i0lb_
  • Chain 'C':
    Compound: peptide E6
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: peptide E6
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2i0lA (A:)
eiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgklqigdkllavnsvc
leevtheeavtalkntsdfvylka

    Sequence, based on observed residues (ATOM records): (download) 
    >2i0lA (A:)
eiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgklqigdkllavnsvc
leevtheeavtalkntsdfvylk

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2i0lB (B:)
eiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgklqigdkllavnsvc
leevtheeavtalkntsdfvylka

    Sequence, based on observed residues (ATOM records): (download) 
    >2i0lB (B:)
eiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgklqigdkllavnsvc
leevtheeavtalkntsdfvylk

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.