SCOPe 2.08: Domain d2hfca1: 2hfc A:2-237

Lineage for d2hfca1 (2hfc A:2-237)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (6 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries)
   Uniprot P42212

8. Domain d2hfca1: 2hfc A:2-237 [165079]
   Other proteins in same PDB: d2hfca2
   automated match to d1qyoa_
   complexed with mg

Details for d2hfca1

PDB Entry: 2hfc, 1.2 Å

PDB Description: structure of s65t y66f r96a gfp variant in precursor state

PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d2hfca1:

Sequence, based on SEQRES records:

>d2hfca1 d.22.1.1 (A:2-237) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttltfgvqcfsrypdhmkqhdffksampegyvqeatisfkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqladh
yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdely

Sequence, based on observed residues (ATOM records):

>d2hfca1 d.22.1.1 (A:2-237) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttltfgvqcfsrypdhmkqhdffksampegyvqeatisfkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqladh
yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagitly

Timeline for d2hfca1:

• d2hfca1 first appeared in SCOPe 2.01, called d2hfca_
  
• d2hfca1 appears in SCOPe 2.07