![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
![]() | Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
![]() | Protein automated matches [190142] (15 species) not a true protein |
![]() | Species Salmonella typhimurium [TaxId:99287] [187772] (1 PDB entry) |
![]() | Domain d2guwc_: 2guw C: [164848] automated match to d1t8ra_ |
PDB Entry: 2guw (more details), 2.64 Å
SCOPe Domain Sequences for d2guwc_:
Sequence, based on SEQRES records: (download)
>d2guwc_ c.56.2.1 (C:) automated matches {Salmonella typhimurium [TaxId: 99287]} ltpeqaldrleelyeqsvnalreaiadyvdngtlpdpharlnglfvypslsvswdgatpn ppktrafgrfthpgcytttvtrpalfraylleqlnlvyhdygahiaveashheipypyvi dgsaltldrsmsagltrhfpttelaqigdetadglfhpgefyplshfdarrvdfslarlr hytgtpvehfqpfvlftnytryvdefvrwgcsqildpdspyialscaggiwitaeteape eaisdlawkkhqmpawhlvtadgqgitlvnigvgpsnakticdhlavlrpdvwlmighcg glresqaigdyvlahaylrddhvldavlppdipipsiaevqralydatkavsgmpgeevk qrlrtgtvvttddrnwelrysasalrfnlsravaidmesatiaaqgyrfrvpygtllcvs dkplhgeiklpgqanrfyegaisehlqigiraidllraeg
>d2guwc_ c.56.2.1 (C:) automated matches {Salmonella typhimurium [TaxId: 99287]} ltpeqaldrleelyeqsvnalreaiadyvdngtlpdpharlnglfvypslsvtttvtrpa lfraylleqlnlvyhdygahiaveashheipypyvidgsaltldrsmsagltrhfpttef darrvdfslarlrhytgtpvehfqpfvlftnytryvdefvrwgcsqildpdspyialsca ggiwitaeteadlawkkhqmpawhlvtadgqgitlvnigvgpsnakticdhlavlrpdvw lmighcgglresqaigdyvlahaylrddhvldavlppdipipsiaevqralydatkavsg mpgeevkqrlrtgtvvttddrnwelrysasalrfnlsravaidmesatiaaqgyrfrvpy gtllcvsdkplhgeaisehlqigiraidllraeg
Timeline for d2guwc_: